PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G008100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 668aa    MW: 71378.7 Da    PI: 6.5081
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G008100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.91.8e-1273006602374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPil 91 
                          +lLl+cAe v++++l  a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ lpp + +  + + +++aa+++f+ +sP++
  Sevir.8G008100.1.p 300 LTLLLQCAEXVNADNLDDAHQTLLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPPASPAAARlHGRVAAAFQVFNGISPFV 390
                         579************************************************************77666655548899999*********** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s e+l++tg+rL++fA++lg+pfef + v
  Sevir.8G008100.1.p 391 KFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALQATGKRLSDFADTLGLPFEFCA-V 476
                         **********************************************************....***************************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         a++  ++++e+L v ++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysalfdsl+a
  Sevir.8G008100.1.p 477 AEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALFDSLDA 560
                         *************************9..999999999999....**********************.899********************* PP

                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                         +++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF++++l  +aa+qa+lll +++sdgy++ ee+g l lgWkd
  Sevir.8G008100.1.p 561 SYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRSASLAGSAAAQASLLLGMFPSDGYTLVEENGXLKLGWKD 650
                         *******************************999987.***************************************************** PP

                GRAS 365 rpLvsvSaWr 374
                           L+++SaWr
  Sevir.8G008100.1.p 651 LCLLTASAWR 660
                         *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.598273640IPR005202Transcription factor GRAS
PfamPF035146.3E-125300660IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MGSSSLLLFP SSSSAASPAY SHATASTSSH SSLLPPLPSP QDHHLLQYLH HLDQQQQESA  60
AMVRKRPAPD MDLPPPRRHV TGDLSDVTAA AASGGGAPPP QSAAASAQLP ALPTQLHLPA  120
FQVQHHHHHH HAEVDAPPAG EVAASTTAWV DGIIRDIIGS SGGAXVSVAQ LIHNVREIIH  180
PCNPGLASLL ELRLRSLLNA ADPAAPLHQP LPHPPALPPV PALPPPPPPQ LTVTDKRRHE  240
PQQXGEPTNP SPQQEEPKPP TAEETAAAAA AAAAAAAAAA KERKEEQRRK QRDEEGLHLL  300
TLLLQCAEXV NADNLDDAHQ TLLEIAELAT PFGTSTQRVA AYFAEAMSAR LVSSCLGLYA  360
PLPPASPAAA RLHGRVAAAF QVFNGISPFV KFSHFTANQA IQEAFEREER VHIIDLDIMQ  420
GLQWPGLFHI LASRPGGPPR VRLTGLGASM EALQATGKRL SDFADTLGLP FEFCAVAEKA  480
GNVDPEKLGV TRREAVAVHW LHHSLYDVTG SDSNTLWLIQ RLAPKVVTMV EQDLSHSGSF  540
LARFVEAIHY YSALFDSLDA SYGEDSPERH VVEQQLLSRE IRNVLAVGGP ARTGDVKFGS  600
WREKLAQSGF RSASLAGSAA AQASLLLGMF PSDGYTLVEE NGXLKLGWKD LCLLTASAWR  660
PIQTPCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-532996604375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977413.10.0PREDICTED: protein SCARECROW 1-like
SwissprotA2ZHL00.0SCR2_ORYSI; Protein SCARECROW 2
SwissprotQ2QYF30.0SCR2_ORYSJ; Protein SCARECROW 2
TrEMBLA0A0E0RD240.0A0A0E0RD24_ORYRU; Uncharacterized protein
STRINGLOC_Os12g02870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein